![VIP (human, mouse, rat) . AcOH [RLF-100]](https://www.axilscientific.com/78553-superlarge_default/vip-human-mouse-rat-acoh-rlf-100-.jpg)
VIP (human, mouse, rat) . AcOH [RLF-100]
Brand:
11-083
- Brand
- ProSci
- CAS
- 444827-29-5 | 40077-57-4 (free base)
- Solubility
- Soluble in water or aqueous solution (1% AcOH) (1mg/ml).
- Product Link
- https://www.prosci-inc.com/product/vip-human-mouse-rat-acoh-rlf-100-11-083/
- Storage
- Short Term Storage: +4C. Long Term Storage: -20C. Handling Advice: Keep cool and dry. Use/Stability: Stable for at least 2 years after receipt when stored at -20C.
- Purity
- greater than or equal to 98% (HPLC)
- Predicted Molecular Weight
- 3325.8 . 60.0 / sequence: H-His-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Leu-Asn-NH2
- Physical State
- Lyophilized
- Additional Names
- Aviptadil; HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2; Vasoactive Intestinal Peptide; Vasoactive Intestinal Octacosapeptide
- Formula
- C147H238N44O42S . C2H4O2
- InChi Key
- ZPFJSONBPCXUTA-KAZBKGEHSA-N
Related products
